Invitrogen™ Human SCUBE2 (aa 476-614) Control Fragment Recombinant Protein

Product Code. 30201402

Brand: Invitrogen™ RP88796

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56278 (PA5-56278. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SCUBE2 is a member of a family of secreted glycoproteins that contain N-terminal EGF-like repeats and C-terminal cysteine-rich motifs and CUB domain and are expressed in embryonic neuroectoderm and vascular epithelium. SCUBE2 is a close homolog to SCUBE1 and can form a heterodimeric complex with SCUBE1. SCUBE2 is thought to participate in the Hedgehog signaling pathway by specifically interacting with Sonic Hedgehog (SHH) and the receptor PTCH1, enhancing the SHH signaling activity in the raft microdomains of the plasma membrane, and may thus play important roles in organ development and tumor progression.

Specifications

• Accession Number: Q9NQ36
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57758
• Name: Human SCUBE2 (aa 476-614) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CEGB1; CEGF1; CEGP1; Protein CEGP1; RGD1563998; Scube/You; SCUBE2; Scube2-ps1; signal peptide; Signal peptide, CUB and EGF-like domain-containing protein 2; signal peptide, CUB domain and EGF like domain containing 2; signal peptide, CUB domain, EGF-like 2; signal peptide, CUB domain, EGF-like 2, pseudogene 1
• Common Name: SCUBE2
• Gene Symbol: SCUBE2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SGIHLSSDVTTIRTSVTFKLNEGKCSLKNAELFPEGLRPALPEKHSSVKESFRYVNLTCSSGKQVPGAPGRPSTPKEMFITVEFELETNQKEVTASCDLSCIVKRTEKRLRKAIRTLRKAVHREQFHLQLSGMNLDVAK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining