Invitrogen™ Human SCRT1 (aa 35-79) Control Fragment Recombinant Protein

Product Code. 30210523

Brand: Invitrogen™ RP100027

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60966 (PA5-60966. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the Snail family of C2H2-type zinc finger transcription factors. It codes for a neural-specific transcriptional repressor that binds to E-box motifs. The protein may promote neural differention and may be involved in cancers with neuroendocrine features.

Specifications

• Accession Number: Q9BWW7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 83482
• Name: Human SCRT1 (aa 35-79) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: mScrt; scratch 1; scratch family transcriptional repressor 1; scratch family zinc finger 1; scratch homolog 1 zinc finger protein; scratch homolog 1, zinc finger protein; scratch homolog 1, zinc finger protein (Drosophila); SCRT; Scrt1; Transcriptional repressor scratch 1; ZNF898
• Common Name: SCRT1
• Gene Symbol: Scrt1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LHDKGYLSDYVGPSSVYDGDAEAALLKGPSPEPMYAAAVRGELGP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining