Invitrogen™ Human SCP3 (aa 150-236) Control Fragment Recombinant Protein

Product Code. 30182236

Brand: Invitrogen™ RP97796

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58867 (PA5-58867. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes an essential structural component of the synaptonemal complex. This complex is involved in synapsis, recombination and segregation of meiotic chromosomes. Mutations in this gene are associated with azoospermia in males and susceptibility to pregnancy loss in females. Alternate splicing results in multiple transcript variants that encode the same protein.

Specifications

• Accession Number: Q8IZU3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 50511
• Name: Human SCP3 (aa 150-236) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Cor1; LOC615896 protein; RNASCP3; RPRGL4; Scp3; SCP-3; SPGF4; Sycp3; Synaptonemal complex protein 3; synaptonemal complex protein 3-like
• Common Name: SCP3
• Gene Symbol: Sycp3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ILNMFRQQQKILQQSRIVQSQRLKTIKQLYEQFIKSMEELEKNHDNLLTGAQNEFKKEMAMLQKKIMMETQQQEIASVRKSLQSMLF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining