Invitrogen™ Human SCOC (aa 81-148) Control Fragment Recombinant Protein

Product Code. 30199409

Brand: Invitrogen™ RP103785

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-66372 (PA5-66372, PA5-64439 (PA5-64439. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Positive regulator of amino acid starvation-induced autophagy.

Specifications

• Accession Number: Q9UIL1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 60592
• Name: Human SCOC (aa 81-148) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: HRIHFB2072; SCOC; SCOCO; short coiled coil protein; short coiled-coil protein; UNC-69
• Common Name: SCOC
• Gene Symbol: SCOC
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ADMDAVDAENQVELEEKTRLINQVLELQHTLEDLSARVDAVKEENLKLKSENQVLGQYIENLMSASSV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining