Invitrogen™ Human SCO1 (aa 169-229) Control Fragment Recombinant Protein

Product Code. 30197928

Brand: Invitrogen™ RP93315

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54460 (PA5-54460. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Synthesis of cytochrome c oxidase 1 was initially identified in yeast as one of two cytochrome c oxidase (COX) assembly proteins that enable the assembly of cytochrome c holoenzyme, a complex that catalyzes the transfer of reducing equivalents from cytochrome c to molecular oxygen and pumps protons across the inner mitochondrial membrane. Like their yeast homologs, the function of both SCO1 and SCO2 are dependent on copper ion binding. Mutations in either gene can lead to cytochrome c oxidase respiratory chain defects, with a missense mutation in human SCO1 (P174L) associated with a fatal neonatal hepatopathy when the second allele is also non-functional, suggesting the pathology is due to loss of function. It has been suggested that this mutation alters the SCO1 affinity for the copper (I) ion, thus impairing the efficiency of copper transfer to the cytochrome c oxidase.

Specifications

• Accession Number: O75880
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6341
• Name: Human SCO1 (aa 169-229) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610001C07Rik; D11Bwg1310e; Protein SCO1 homolog, mitochondrial; RGD1559538; SCO cytochrome c oxidase assembly protein 1; SCO cytochrome oxidase deficient homolog 1; SCO cytochrome oxidase deficient homolog 1 (yeast); SCO1; SCO1 cytochrome c oxidase assembly protein; SCO1, cytochrome c oxidase assembly protein; SCOD1; synthesis of cytochrome C oxidase 1
• Common Name: SCO1
• Gene Symbol: SCO1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining