Invitrogen™ Human SCNN1B (aa 333-476) Control Fragment Recombinant Protein

Product Code. 30212260

Brand: Invitrogen™ RP90439

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53342 (PA5-53342. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception. Heterotetramer of two alpha, one beta and one gamma subunit. A delta subunit can replace the alpha subunit. Interacts with the WW domains of NEDD4, NEDD4L, WWP1 and WWP2. Defects in SCNN1B are a cause of autosomal recessive pseudohypoaldosteronism type 1 (PHA1) [MIM:264350]. PHA1 is a rare salt wasting disease resulting from target organ unresponsiveness to mineralocorticoids. There are 2 forms of PHA1: the autosomal recessive form that is severe, and the dominant form which is more milder and due to defects in mineralocorticoid receptor. Autosomal recessive PHA1 is characterized by an often fulminant presentation in the neonatal period with dehydration, hyponatraemia, hyperkalaemia, metabolic acidosis, failure to thrive and weight loss. Defects in SCNN1B are a cause of Liddle syndrome. It is an autosomal dominant disorder characterized by pseudoaldosteronism and hypertension associated with hypokalemic alkalosis. The disease is caused by constitutive activation of the renal epithelial sodium channel.

Specifications

• Accession Number: P51168
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6338
• Name: Human SCNN1B (aa 333-476) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Amiloride-sensitive sodium channel subunit beta; amiloride-sensitive sodium channel subunit beta 1; amiloride-sensitive sodium channel subunit beta-like protein; BESC1; Beta ENaC; beta-ENaC; Beta-NaCH; betaxENaC; ENaC beta; ENaCb; enacbeta; epithelial Na(+) channel subunit beta; epithelial sodium channel beta-2 subunit; epithelial sodium channel beta-3 subunit; epithelial sodium channel, nonvoltage-gated 1, beta; nasal epithelial sodium channel beta subunit; nonvoltage-gated sodium channel 1 subunit beta; RNENACB; SCNEB; SCNN 1 B; SCNN1B; scnn1b.L; scnn1b-a; scnn1b-b; sodium channel epithelial 1 beta subunit; sodium channel, non voltage gated 1 beta subunit; sodium channel, non voltage gated 1 beta subunit L homeolog; sodium channel, nonvoltage-gated 1 beta; sodium channel, nonvoltage-gated 1, beta; sodium channel, non-voltage-gated 1, beta subunit; sodium channel, nonvoltage-gated, type I, beta; XELAEV_18045378mg
• Common Name: SCNN1B
• Gene Symbol: SCNN1B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining