Invitrogen™ Human SCN4A (aa 1747-1797) Control Fragment Recombinant Protein

Product Code. 30212049

Brand: Invitrogen™ RP101083

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84179 (PA5-84179. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Voltage-gated sodium channels are selective ion channels that regulate the permeability of sodium ions in excitable cells. During the propagation of an action potential, sodium channels allow an influx of sodium ions, which rapidly depolarize the cell. The three glycoproteins that comprise the voltagegated sodium channel proteins include a pore-forming alpha subunit, a noncovalently associated beta1 subunit and a disulfide-linked beta2 subunit. The two beta subunits regulate the level of channel expression, modulate gating and function as cell adhesion molecules for cellular aggregation and cytoskeleton interaction. The alpha subunits of sodium channels type I and III are predominantly expressed in neuronal cell bodies and proximal processes, while type II alpha subunits are more abundant along axons. The beta1 subunit of sodium channel type I is expressed in brain, skeletal and cardiac muscle. In the brain, beta1 and beta2 are highly expressed in Purkinje cells, and beta1 is also expressed in the pyramidal cells of the deep cerebellar nuclei. Impaired voltage-gated sodium channels lead to a number of diseases including myotonia.

Specifications

• Accession Number: P35499
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6329
• Name: Human SCN4A (aa 1747-1797) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CMS16; CTC-264K15.6; hNaN; HOKPP2; HYKPP; HYPP; KIAA1356; MED; mH2; microI; Mu-1; Na(V)1.4; NAC1; NAC1A; NAC2; NAC3; Nav1.1; Nav1.2; Nav1.3; Nav1.4; Nav1.5; Nav1.6; Nav1.7; Nav1.8; Nav1.9; NCHVS; NENA; SCN1; SCN10A; SCN11A; SCN12A; SCN1A; SCN2A; SCN2A1; SCN2A2; SCN3A; Scn4a; SCN5A; SCN8A; SCN9A; skeletal muscle sodium channel alpha subunit; skeletal muscle voltage-dependent sodium channel type IV alpha subunit; skM1; SNS2; sodium channel alpha-subunit; sodium channel protein skeletal muscle subunit alpha; Sodium channel protein type 4 subunit alpha; sodium channel protein type IV subunit alpha; sodium channel voltage-gated type 4 alpha polypeptide; Sodium channel voltage-gated type IV alpha polypeptide; sodium channel, voltage gated, type IV alpha subunit; sodium channel, voltage-gated, type 4, alpha polypeptide; sodium channel, voltage-gated, type 4, alpha subunit; sodium channel, voltage-gated, type IV, alpha; sodium channel, voltage-gated, type IV, alpha polypeptide; sodium channel, voltage-gated, type IV, alpha subunit; sodium voltage-gated channel alpha subunit 4; voltage-gated sodium channel subunit alpha Nav1.4
• Common Name: SCN4A
• Gene Symbol: SCN4A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MKQASYMYRHSHDGSGDDAPEKEGLLANTMSKMYGHENGNSSSPSPEEKGE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining