Invitrogen™ Human SCN11A (aa 817-886) Control Fragment Recombinant Protein

Codice prodotto. 30212546

Marca: Invitrogen™ RP96436

Descrizione

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (53%), Rat (53%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57794 (PA5-57794. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Epithelial sodium channels are amiloride-sensitive members of the Degenerin/epithelial sodium channel (Deg/ENaC) superfamily of ion channels. Members of this superfamily of ion channels share organizational similarity in that they all possess two short intracellular amino and carboxyl termini, two short membrane spanning segments, and a large extracellular loop with a conserved cysteine-rich region. There are three homologous isoforms of the ENaC (alpha, beta, and gamma) protein. ENaC in the kidney, lung, and colon plays an essential role in trans-epithelial sodium and fluid balance. ENaC also mediates aldosterone-dependent sodium reabsorption in the distal nephron of the kidney, thus regulating blood pressure. ENaC is thought to be regulated, in part, through association with the cystic fibrosis transmembrane conductance regulator (CFTR) chloride ion channel. Gain-of-function mutations in beta- or gamma-ENaC can cause severe arterial hypertension (Liddels syndrome) and loss-of-function mutations in alpha- or beta-ENaC causes pseudohypoaldosteronism (PHA-1).

Specifica

• Accession Number: Q9UI33
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 11280
• Name: Human SCN11A (aa 817-886) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: FEPS3; hNaN; HSAN7; Nan; NaT; NaV1.9; NSS2; Peripheral nerve sodium channel 5; PN5; Scn11a; SCN12A; sensory neuron sodium channel 2; SNS2; SNS-2; Sodium channel protein type 11 subunit alpha; sodium channel protein type XI subunit alpha; sodium channel voltage-gated type 11 alpha polypeptide; sodium channel voltage-gated type XI alpha polypeptide; sodium channel, voltage gated, type XI alpha subunit; sodium channel, voltage-gated, type 11, alpha polypeptide; sodium channel, voltage-gated, type XI, alpha; sodium channel, voltage-gated, type XI, alpha polypeptide; sodium channel, voltage-gated, type XI, alpha subunit; sodium channel, voltage-gated, type XII, alpha polypeptide; sodium channel, voltage-gated, type11, alpha polypeptide; sodium voltage-gated channel alpha subunit 11; voltage-gated sodium channel NAV1.9 b; voltage-gated sodium channel subunit alpha Nav1.9
• Common Name: SCN11A
• Gene Symbol: SCN11A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EERNGNLEGEARKTKVQLALDRFRRAFCFVRHTLEHFCHKWCRKQNLPQQKEVAGGCAAQSKDIIPLVME
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining