Invitrogen™ Human SCML2 (aa 574-656) Control Fragment Recombinant Protein

Product Code. 30207501

Brand: Invitrogen™ RP107363

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (57%), Rat (57%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84666 (PA5-84666. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SCML2 is a putative component of a Polycomb group (PcG) multiprotein complex involved in represing transcription of homeotic genes during development. It mediates chromatin remodeling and DNA dependent negative regulation of transcription by binding to methylated lysine residues in histone tails.

Specifications

• Accession Number: Q9UQR0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10389
• Name: Human SCML2 (aa 574-656) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4932420G07Rik; Scm polycomb group protein like 2; SCML2; sex comb on midleg-like 2 (Drosophila); sex comb on midleg-like protein 2
• Common Name: SCML2
• Gene Symbol: SCML2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SRSVPGTTSSPLVGDISPKSSPHEVKFQMQRKSEAPSYIAVPDPSVLKQGFSKDPSTWSVDEVIQFMKHTDPQISGPLADLFR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining