Invitrogen™ Human SCGB2B2 (aa 24-96) Control Fragment Recombinant Protein

Product Code. 30181495

Brand: Invitrogen™ RP99233

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (23%), Rat (23%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61335 (PA5-61335. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q4G0G5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 284402
• Name: Human SCGB2B2 (aa 24-96) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: SCGB2B2; SCGB4A2; SCGBL; secretoglobin family 2 B member 2; secretoglobin, family 2 B, member 2; secretoglobin-like protein
• Common Name: SCGB2B2
• Gene Symbol: SCGB2B2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CLDIDKLLANVVFDVSQDLLKEELARYNPSPLTEESFLNVQQCFANVSVTERFAHSVVIKKILQSNDCIEAAF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining