Invitrogen™ Human SCF (aa 236-266) Control Fragment Recombinant Protein

Product Code. 30194195

Brand: Invitrogen™ RP107748

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Stem cell factor (SCF) is the ligand of the c-Kit oncogene and is expressed by various structural and inflammatory cells in the airways. Binding of SCF by the c-Kit receptor leads to homodimerization of the receptor and the activation of signalling pathways such as PI-3, PLC-gamma, Jak/STAT, and MAP kinase pathways. SCF expression leads to the induction of mast cell survival and the expression and release of histamine, pro-inflammatory cytokines and chemokines. The inhibition of the SCF/c-Kit pathway leads to a decrease in histamine levels, mast cell and eosinophil infiltration, IL-4 production and airway hyperresponsiveness, suggesting this pathway may be a useful therapeutic target in inflammatory diseases such as asthma. At least two isoforms of SCF are known to exist.

Specifications

• Accession Number: P21583
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4254
• Name: Human SCF (aa 236-266) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 710-712; blz; c-Kit ligand; Clo; cloud gray; Con; contrasted; CSF; DCUA; DFNA69; DKFZp686F2250; familial progressive hyperpigmentation 2; FPH2; FPHH; Gb; grizzle-belly; hematopoietic growth factor KL; H-SCF; Kit ligand; Kitl; Kitlg; kit-ligand; KL-1; Mast cell growth factor; MGF; M-SCF; Processed kit ligand; SCF; SF; SHEP7; sKITLG; Sl; SLF; Soluble KIT ligand; Steel factor; steel factor/kit ligand; stem cell factor; stem cell factor KL-1; stem cell factor, CSF
• Common Name: SCF
• Gene Symbol: KITLG
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YWKKRQPSLTRAVENIQINEEDNEISMLQEK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining