Invitrogen™ Human SCARA3 (aa 311-435) Control Fragment Recombinant Protein

Product Code. 30196237

Brand: Invitrogen™ RP105816

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65053 (PA5-65053. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Seems to protect cells by scavenging oxidative molecules or harmful products of oxidation.

Specifications

• Accession Number: Q6AZY7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51435
• Name: Human SCARA3 (aa 311-435) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: APC7; C130058N24Rik; cellular stress response gene protein; cellular stress response protein; CSR; CSR1; macrophage scavenger receptor-like 1; MSLR1; MSRL1; Scara3; Scavenger receptor class A member 3; scavenger receptor class A, member 3
• Common Name: SCARA3
• Gene Symbol: SCARA3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LDNISSFLDDHEENMHDLQYHTHYAQNRTVERFESLEGRMASHEIEIGTIFTNINATDNHVHSMLKYLDDVRLSCTLGFHTHAEELYYLNKSVSIMLGTTDLLRERFSLLSARLDLNVRNLSMIV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining