Invitrogen™ Human SCAMP5 (aa 181-234) Control Fragment Recombinant Protein

Product Code. 30203254

Brand: Invitrogen™ RP95740

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61269 (PA5-61269. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Secretory carrier membrane proteins (SCAMPs) are proteins that are components of post-Golgi membranes. These proteins are implicated to function in membrane trafficking. In fibroblasts, SCAMPs are concentrated in compartments that are involved in the recycling of cell surface receptors and endocytosis. In neurons, SCAMPs are associated with synaptic vesicles, secretion granules and transporter vesicles. SCAMPs are composed of four central transmembrane regions and a cytoplasmic tail. Of the five known SCAMPs, SCAMPs 1-3 contain cytoplasmic N-terminal regions with NPF repeats. NPF repeats are found to interact with EH domain proteins that function in budding of transport vesicles from the plasma membrane or the Golgi complex. SCAMPs 4 and 5 lack the N-terminal NPF repeats. SCAMPs 1-4 are all ubiquitously coexpressed while SCAMP 5 is only detectable in the brain. Studies show that SCAMP 5 is expressed late in development which is coincident with expansion of mature synapses.

Specifications

• Accession Number: Q8TAC9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 192683
• Name: Human SCAMP5 (aa 181-234) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: hSCAMP5; Sc5; scamp5; scamp5a; Secretory carrier membrane protein 5; secretory carrier membrane protein 5 A; secretory carrier membrane protein 5-like; secretory carrier-associated membrane protein 5; wu:fc30b07; zgc:77438
• Common Name: SCAMP5
• Gene Symbol: SCAMP5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMNQPQTQYSATPNYTYSNE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining