Invitrogen™ Human SCAMP3 (aa 1-55) Control Fragment Recombinant Protein

Product Code. 30209534

Brand: Invitrogen™ RP105521

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67150 (PA5-67150. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene product belongs to the SCAMP family of proteins which are secretory carrier membrane proteins. They function as carriers to the cell surface in post-golgi recycling pathways. Different family members are highly related products of distinct genes, and are usually expressed together. These findings suggest that the SCAMPs may function at the same site during vesicular transport rather than in separate pathways. Two transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: O14828
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10067
• Name: Human SCAMP3 (aa 1-55) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C1orf3; propin 1; PROPIN1; Sc3; scamp3; Secretory carrier membrane protein 3; secretory carrier membrane protein 3 isoform 1; secretory carrier-associated membrane protein 3; TU52; zgc:103488
• Common Name: SCAMP3
• Gene Symbol: SCAMP3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining