missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SCAF11 (aa 1114-1196) Control Fragment Recombinant Protein

Product Code. 30201292
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30201292 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30201292 Supplier Invitrogen™ Supplier No. RP106114

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65434 (PA5-65434. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Plays a role in pre-mRNA alternative splicing by regulating spliceosome assembly.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q99590
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9169
Name Human SCAF11 (aa 1114-1196) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110061H03Rik; 17D9; 2610510E10Rik; AI462454; CASP11; Caspase11; Caspase-11; CTD-associated SR protein 11; mKIAA3013; p30 subunit; protein SCAF11; Renal carcinoma antigen NY-REN-40; SC35-interacting protein 1; Scaf11; serine/arginine-rich splicing factor 2, interacting protein; serine/arginine-rich splicing factor 2-interacting protein; SFRS2-interacting protein; SFRS2IP; SIP1; splicing factor, arginine/serine-rich 2, interacting protein; splicing factor, arginine/serine-rich 2-interacting protein; Splicing regulatory protein 129; SR-related and CTD-associated factor 11; SR-related CTD associated factor 11; SR-related CTD-associated factor 11; SRrp129; SRSF2-interacting protein; SRSF2IP
Common Name SCAF11
Gene Symbol SCAF11
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SFKFVEQQSYKRKSEQEFSFDTPADRSGWTSASSWAVRKTLPADVQNYYSRRGRNSSGPQSGWMKQEEETSGQDSSLKDQTNQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.