Invitrogen™ Human SBSPON (aa 40-109) Control Fragment Recombinant Protein

Product Code. 30198748

Brand: Invitrogen™ RP93869

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56202 (PA5-56202. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SBSPON gene ontology annotations related to this gene include immune response.

Specifications

• Accession Number: Q8IVN8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 157869
• Name: Human SBSPON (aa 40-109) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C14H8orf84; C29H8orf84; C8orf84; Gm106; RGD1559717; RPE spondin; Rpesp; RPE-spondin; Sbspon; somatomedin B and thrombospondin type 1 domain containing; somatomedin B and thrombospondin, type 1 domain containing; somatomedin-B and thrombospondin type-1 domain-containing protein
• Common Name: SBSPON
• Gene Symbol: Sbspon
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GWRLDRVYGTCFCDQACRFTGDCCFDYDRACPARPCFVGEWSPWSGCADQCKPTTRVRRRSVQQEPQNGG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining