Invitrogen™ Human SATB1 (aa 39-97) Control Fragment Recombinant Protein

Product Code. 30200375

Brand: Invitrogen™ RP109213

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SATB1 (DNA-binding protein SATB1) is a crucial silencing factor that contributes to the initiation of X inactiviation mediated by Xist RNA that occurs during embryogenesis and in lymphoma. SATB1 binds to DNA at special AT-rich sequences, the consensus SATB1-binding sequence, and at nuclear matrix- or scaffold-associated regions. It is thought to recognize the sugar-phosphate structure of double-stranded DNA. SATB1 is also a transcriptonal repressor controlling nuclear and viral gene expression in a phosphorylated and acetylated status-dependent manner by binding to matrix attachment regions of DNA and inducing a local chromatin-loop remodeling. SATB1 modulates the genes that are essential in the maturatio of the immune T-cell CD8SP from thymocytes. Alu-like motifs and SATB1-binding sites provide an unique chromatin context which seems preferentially targeted by the HIV-1 integration machinery. Moreover, HIV-1 Tat may overcome SATB1-mediated repression of IL1 and IL2RA in T-cells by binding to the same domain as HDAC1.

Specifications

• Accession Number: Q01826
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6304
• Name: Human SATB1 (aa 39-97) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610306G12Rik; AW413156; DNA-binding protein SATB1; SATB homeobox 1; Satb1; special AT-rich sequence binding protein 1; special AT-rich sequence binding protein 1 (binds to nuclear matrix/scaffold-associating DNA); special AT-rich sequence-binding protein 1
• Common Name: SATB1
• Gene Symbol: Satb1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PLGRGRLGSTGAKMQGVPLKHSGHLMKTNLRKGTMLPVFCVVEHYENAIEYDCKEEHAE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining