Invitrogen™ Human SART1 (aa 271-345) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30207806	100 μL	100µL

Product Code. 30207806 Supplier Invitrogen™ Supplier No. RP95145

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56663 (PA5-56663. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes two proteins, the SART1protein expressed in the nucleus of the majority of proliferating cells, and the SART1protein expressed in the cytosol of epithelial cancers. The SART1protein is translated by the mechanism of -1 frameshifting during posttranscriptional regulation; its full-length sequence is not published yet. The two encoded proteins are thought to be involved in the regulation of proliferation. Both proteins have tumor-rejection antigens. The SART1protein possesses tumor epitopes capable of inducing HLA-A2402-restricted cytotoxic T lymphocytes in cancer patients. This SART1antigen may be useful in specific immunotherapy for cancer patients and may serve as a paradigmatic tool for the diagnosis and treatment of patients with atopy. The SART1protein is found to be essential for the recruitment of the tri-snRNP to the pre-spliceosome in the spliceosome assembly pathway.

Specifications

• Accession Number: O43290
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9092
• Name: Human SART1 (aa 271-345) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Ara1; Haf; Hom s 1; HOMS1; hSART-1; hSnu66; Hypoxia-associated factor; IgE autoantigen; MGC2038; mSART-1; rSART-1; Sart1; SART-1; SART1(259) protein; SART1(800) protein; SART1259; small nuclear ribonucleoprotein 110 kDa (U4/U6.U5); SNRNP110; Snu66; SNU66 homolog; squamous cell carcinoma antigen recognised by T cells; squamous cell carcinoma antigen recognized by T cells; squamous cell carcinoma antigen recognized by T cells 1; squamous cell carcinoma antigen recognized by T-cells 1; U4/U6.U5 tri-snRNP-associated 110 kDa protein; U4/U6.U5 tri-snRNP-associated protein 1; U5-110 K
• Common Name: SART1
• Gene Symbol: SART1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TMILTLKDKGVLQEEEDVLVNVNLVDKERAEKNVELRKKKPDYLPYAEDESVDDLAQQKPRSILSKYDEELEGER
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining