Invitrogen™ Human SAPS2 (aa 1-125) Control Fragment Recombinant Protein

Product Code. 30211275

Brand: Invitrogen™ RP91377

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56531 (PA5-56531. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Regulatory subunit of protein phosphatase 6 (PP6). May function as a scaffolding PP6 subunit. Involved in the PP6- mediated dephosphorylation of NFKBIE opposing its degradation in response to TNF-alpha.

Specifications

• Accession Number: O75170
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9701
• Name: Human SAPS2 (aa 1-125) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110033O10Rik; 8430411H09Rik; B230107H12Rik; KIAA0685; Pp6r2; PPP6R2; protein phosphatase 6 regulatory subunit 2; protein phosphatase 6, regulatory subunit 2; SAP190; SAPS domain family member 2; SAPS domain family, member 2; Saps2; Serine/threonine-protein phosphatase 6 regulatory subunit 2
• Common Name: SAPS2
• Gene Symbol: PPP6R2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MFWKFDLNTTSHVDKLLDKEHVTLQELMDEDDILQECKAQNQKLLDFLCRQQCMEELVSLITQDPPLDMEEKVRFKYPNTACELLTCDVPQISDRLGGDESLLSLLYDFLDHEPPLNPLLASFFS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining