Invitrogen™ Human SAPK4 (aa 220-357) Control Fragment Recombinant Protein

Product Code. 30204987

Brand: Invitrogen™ RP89798

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52465 (PA5-52465. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MAPK13 (p38 delta) is a serine/threonine kinase that transduces a variety of extracellular signals, including cytokine and environmental stress responses. MAPK13 also regulates the differentiation of keratinocytes. This kinase is activated by various environmental stresses and proinflammatory cytokines. The activation requires its phosphorylation by MAP kinase kinases, or its autophosphorylation triggered by the interaction of MAP3K7IP1/TAB1 protein with this kinase. The substrates of this kinase include transcription regulator ATF2, MEF2C, and MAX, cell cycle regulator CDC25B, and tumor suppressor p53, which suggest the roles of this kinase in stress related transcription and cell cycle regulation, as well as in genotoxic stress response. Four alternatively spliced transcript variants of SAPK4 encoding distinct isoforms have been reported.

Specifications

• Accession Number: O15264
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5603
• Name: Human SAPK4 (aa 220-357) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: im:7136778; MAP kinase 13; MAP kinase p38 delta; MAPK 13; Mapk13; MAPK-13; mitogen activated protein kinase 13; mitogen-activated protein kinase 13; Mitogen-activated protein kinase p38 delta; p38 delta MAP kinase; p38delta; PRKM13; SAPK/Erk/kinase 4; SAPK4; Serk4; Stress-activated protein kinase 4
• Common Name: SAPK4
• Gene Symbol: MAPK13
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining