missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SAMSN1 (aa 42-165) Control Fragment Recombinant Protein

Product Code. 30196130
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30196130 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30196130 Supplier Invitrogen™ Supplier No. RP89850

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82400 (PA5-82400. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SAMSN (HACS1) is a member of a novel gene family of putative adaptors and scaffold proteins containing SH3 and SAM (sterile alpha motif) domains. It encodes a 441 amino acid protein that is differentially expressed in hematopoietic cells and malignancies including myeloid leukemia, lymphoma, and myeloma. SAMSN has restricted expression in human tissues. It has been shown to be up-regulated by B cell activation signals and is a participant in B cell activation and differentiation. SAMSN is an immunoinhibitory adaptor that might be a useful target for immune suppression therapy.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NSI8
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 64092
Name Human SAMSN1 (aa 42-165) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4930571B16Rik; 930571B16Rik; HACS1; hematopoietic adapter-containing SH3 and sterile α-motif (SAM) domains 1; hematopoietic adapter-containing SH3 and sterile alpha-motif (SAM) domains 1; hematopoietic adaptor containing SH3 and SAM domains 1; Nash; NASH1; nuclear localization signals, SAM and SH3 domain containing 1; SAM and SH3 domain containing 2; SAM domain, SH3 domain and nuclear localisation signals, 1; SAM domain, SH3 domain and nuclear localization signals 1; SAM domain, SH3 domain and nuclear localization signals protein 1; SAM domain, SH3 domain and nuclear localization signals, 1; SAM domain-containing protein SAMSN-1; SAMSN; Samsn1; SAMSN-1; SASH2; SH3 protein expressed in lymphocytes 2; SH3D6B; SH3-lymphocyte protein 2; SH3-SAM adaptor protein; SLy2; Src homology domain 3 (SH3)-containing adapter protein SH3 lymphocyte protein 2
Common Name SAMSN1
Gene Symbol SAMSN1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TEAHEGDPTNGSGEQSKTSNNGGGLGKKMRAISWTMKKKVGKKYIKALSEEKDEEDGENAHPYRNSDPVIGTHTEKVSLKASDSMDSLYSGQSSSSGITSCSDGTSNRDSFRLDDDGPYSGPFC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.