Invitrogen™ Human SAMSN1 (aa 42-165) Control Fragment Recombinant Protein

Product Code. 30196130

Brand: Invitrogen™ RP89850

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82400 (PA5-82400. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SAMSN (HACS1) is a member of a novel gene family of putative adaptors and scaffold proteins containing SH3 and SAM (sterile alpha motif) domains. It encodes a 441 amino acid protein that is differentially expressed in hematopoietic cells and malignancies including myeloid leukemia, lymphoma, and myeloma. SAMSN has restricted expression in human tissues. It has been shown to be up-regulated by B cell activation signals and is a participant in B cell activation and differentiation. SAMSN is an immunoinhibitory adaptor that might be a useful target for immune suppression therapy.

Specifications

• Accession Number: Q9NSI8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64092
• Name: Human SAMSN1 (aa 42-165) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4930571B16Rik; 930571B16Rik; HACS1; hematopoietic adapter-containing SH3 and sterile α-motif (SAM) domains 1; hematopoietic adapter-containing SH3 and sterile alpha-motif (SAM) domains 1; hematopoietic adaptor containing SH3 and SAM domains 1; Nash; NASH1; nuclear localization signals, SAM and SH3 domain containing 1; SAM and SH3 domain containing 2; SAM domain, SH3 domain and nuclear localisation signals, 1; SAM domain, SH3 domain and nuclear localization signals 1; SAM domain, SH3 domain and nuclear localization signals protein 1; SAM domain, SH3 domain and nuclear localization signals, 1; SAM domain-containing protein SAMSN-1; SAMSN; Samsn1; SAMSN-1; SASH2; SH3 protein expressed in lymphocytes 2; SH3D6B; SH3-lymphocyte protein 2; SH3-SAM adaptor protein; SLy2; Src homology domain 3 (SH3)-containing adapter protein SH3 lymphocyte protein 2
• Common Name: SAMSN1
• Gene Symbol: SAMSN1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TEAHEGDPTNGSGEQSKTSNNGGGLGKKMRAISWTMKKKVGKKYIKALSEEKDEEDGENAHPYRNSDPVIGTHTEKVSLKASDSMDSLYSGQSSSSGITSCSDGTSNRDSFRLDDDGPYSGPFC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining