Invitrogen™ Human SAB (aa 213-313) Control Fragment Recombinant Protein

Product Code. 30199012

Brand: Invitrogen™ RP105088

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66120 (PA5-66120. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Inhibits the auto- and transphosphorylation activity of BTK. Plays a negative regulatory role in BTK-related cytoplasmic signaling in B-cells. May be involved in BCR-induced apoptotic cell death.

Specifications

• Accession Number: O60239
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9467
• Name: Human SAB (aa 213-313) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI606498; Sab; SH3 binding protein; SH3 domain binding protein 5; SH3 domain-binding protein 5; SH3 domain-binding protein that preferentially associates with BTK; SH3BP5; SH3BP-5; SH3-domain binding protein 5 (BTK-associated); Vascular endothelial cell-specific protein 18; Vesp18
• Common Name: SAB
• Gene Symbol: SH3BP5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ELKAKYYVQLEQLKKTVDDLQAKLTLAKGEYKMALKNLEMISDEIHERRRSSAMGPRGCGVGAEGSSTSVEDLPGSKPEPDAISVASEAFEDDSCSNFVSE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining