Invitrogen™ Human SAA4 (aa 25-63) Control Fragment Recombinant Protein

Product Code. 30210271

Brand: Invitrogen™ RP100823

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63819 (PA5-63819. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SAA4 is a major acute phase reactant. It is an Apolipoprotein of the HDL complex.

Specifications

• Accession Number: P35542
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6291
• Name: Human SAA4 (aa 25-63) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: amyloid A-5 protein; Constitutively expressed serum amyloid A protein; CSAA; C-SAA; Saa4; Saa-4; Saa5; Saa-5; serum amyloid A 4; serum amyloid A-4 protein; serum amyloid A4, constitutive
• Common Name: SAA4
• Gene Symbol: Saa4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining