Invitrogen™ Human S100A4 (aa 1-101) Control Fragment Recombinant Protein

Product Code. 30206732

Brand: Invitrogen™ RP88717

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82322 (PA5-82322. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Specifications

• Accession Number: P26447
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6275
• Name: Human S100A4 (aa 1-101) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 18A2; 42 A; calvasculin; CAPL; fibroblast-specific protein-1; FSP1; leukemia multidrug resistance associated protein; malignant transformation suppression 1; metastasin; Metastatic cell protein; Mts1; Nerve growth factor-induced protein 42 A; P9K; P9KA; PeL98; pk9a; Placental calcium-binding protein; pr; protein 18A2; Protein 9 Ka homologous to calcium-binding protein; protein Mts1; Protein S100-A4; RNP9KA; S100 calcium binding protein A4; S100 calcium-binding protein A4; S100 calcium-binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog); S100a4
• Common Name: S100A4
• Gene Symbol: S100a4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining