missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human S100A4 (aa 1-101) Control Fragment Recombinant Protein

Product Code. 30206732
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206732

Brand: Invitrogen™ RP88717

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82322 (PA5-82322. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P26447
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6275
Name Human S100A4 (aa 1-101) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 18A2; 42 A; calvasculin; CAPL; fibroblast-specific protein-1; FSP1; leukemia multidrug resistance associated protein; malignant transformation suppression 1; metastasin; Metastatic cell protein; Mts1; Nerve growth factor-induced protein 42 A; P9K; P9KA; PeL98; pk9a; Placental calcium-binding protein; pr; protein 18A2; Protein 9 Ka homologous to calcium-binding protein; protein Mts1; Protein S100-A4; RNP9KA; S100 calcium binding protein A4; S100 calcium-binding protein A4; S100 calcium-binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog); S100a4
Common Name S100A4
Gene Symbol S100a4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.