Invitrogen™ Human S100A3 (aa 1-40) Control Fragment Recombinant Protein

Product Code. 30211041

Brand: Invitrogen™ RP106689

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66001 (PA5-66001. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has the highest content of cysteines of all S100 proteins, has a high affinity for Zinc, and is highly expressed in human hair cuticle. The precise function of this protein is unknown.

Specifications

• Accession Number: P33764
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6274
• Name: Human S100A3 (aa 1-40) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Protein S100-A3; Protein S-100 E; S100 calcium binding protein A3; S100 calcium-binding protein A3; S100A3; S100E
• Common Name: S100A3
• Gene Symbol: S100A3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining