Invitrogen™ Human S100A12 (aa 3-92) Control Fragment Recombinant Protein

Product Code. 30210096

Brand: Invitrogen™ RP101906

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (40%), Rat (40%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51762 (PA5-51762. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

S100A12 is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100A12 is proposed to be involved in specific calcium-dependent signal transduction pathways and its regulatory effect on cytoskeletal components may modulate various neutrophil activities. S100A12 is also a ligand for RAGE. Interaction with RAGE on mononuclear phagocytes, lymphocytes and endothelium triggers cellular activation. Nuclear factor kappa B, a key transcription factor for inflammatory events, is activated by S100A12/RAGE. S100A12 has also been shown to have anti-microbial properties.

Specifications

• Accession Number: P80511
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6283
• Name: Human S100A12 (aa 3-92) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CAAF1; CAGC; Calcitermin; calcium-binding protein in amniotic fluid 1; calgranulin C; calgranulin-C; CGRP; EN RAGE; ENRAGE; EN-RAGE; Extracellular newly identified RAGE-binding protein; migration inhibitory factor-related protein 6; MRP6; MRP-6; Neutrophil S100 protein; p6; Protein S100 A12; protein S100-A12; S100 calcium binding protein A12; S100 calcium-binding protein A12; S100 calcium-binding protein A12 (calgranulin C); S100A12
• Common Name: S100A12
• Gene Symbol: S100A12
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining