Invitrogen™ Human S-arrestin (aa 11-146) Control Fragment Recombinant Protein

Product Code. 30207479

Brand: Invitrogen™ RP105699

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

S-antigen, also identified as arrestin, is a protein involved in the regulation of phototransduction.

Specifications

• Accession Number: P10523
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6295
• Name: Human S-arrestin (aa 11-146) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 48 kDa protein; A930001K18Rik; Arr1; arrestin; arrestin 1; arrestin1; arrestin-1; DKFZp686D1084; DKFZp686I1383; Irbp; photoreceptor protein/alleged cGMP phosphodiesterase activation modulator; put. S-antigen C-terminus; retinal S antigen; retinal S-antigen; retinal S-antigen (48 KDa protein); rod arrestin; rod photoreceptor arrestin; RP47; Sag; S-AG; SAGMR; SANTI; S-antigen; S-antigen visual arrestin; S-antigen, retina and pineal gland (arrestin); S-antigen; retina and pineal gland (arrestin); S-arrestin; S-arrestin short form; visual arrestin 1
• Common Name: S-arrestin
• Gene Symbol: SAG
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKKVYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAPQDSGKS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining