Invitrogen™ Human RYK (aa 532-604) Control Fragment Recombinant Protein

Product Code. 30207900

Brand: Invitrogen™ RP108656

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111731 (PA5-111731. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RYK is an atypical member of the family of growth factor receptor protein tyrosine kinases, differing from other members at a number of conserved residues in the activation and nucleotide binding domains. This gene product belongs to a subfamily whose members do not appear to be regulated by phosphorylation in the activation segment. It has been suggested that mediation of biological activity by recruitment of a signaling-competent auxiliary protein may occur through an as yet uncharacterized mechanism. A nine nucleotide insertion in some transcripts results in the SLG variant. It is not established whether this is a product of alternative splicing or a second gene, since evidence for a second gene or pseudogene on chromosome 17 exists.

Specifications

• Accession Number: P34925
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6259
• Name: Human RYK (aa 532-604) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW536699; D3S3195; ERK3; ERK-3; growth factor receptor; hydroxyaryl-protein kinase; JTK5; JTK5A; JTK5A protein tyrosine kinase; kinase VIK; Met-related kinase; Mrk; NYK-R; receptor-like tyrosine kinase; RYK; RYK1; tyrosine-protein kinase RYK; Vik
• Common Name: RYK
• Gene Symbol: RYK
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LWELMTLGQTPYVDIDPFEMAAYLKDGYRIAQPINCPDELFAVMACCWALDPEERPKFQQLVQCLTEFHAALG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining