missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RYK (aa 532-604) Control Fragment Recombinant Protein

Product Code. 30207900
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207900

Brand: Invitrogen™ RP108656

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111731 (PA5-111731. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RYK is an atypical member of the family of growth factor receptor protein tyrosine kinases, differing from other members at a number of conserved residues in the activation and nucleotide binding domains. This gene product belongs to a subfamily whose members do not appear to be regulated by phosphorylation in the activation segment. It has been suggested that mediation of biological activity by recruitment of a signaling-competent auxiliary protein may occur through an as yet uncharacterized mechanism. A nine nucleotide insertion in some transcripts results in the SLG variant. It is not established whether this is a product of alternative splicing or a second gene, since evidence for a second gene or pseudogene on chromosome 17 exists.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P34925
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6259
Name Human RYK (aa 532-604) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AW536699; D3S3195; ERK3; ERK-3; growth factor receptor; hydroxyaryl-protein kinase; JTK5; JTK5A; JTK5A protein tyrosine kinase; kinase VIK; Met-related kinase; Mrk; NYK-R; receptor-like tyrosine kinase; RYK; RYK1; tyrosine-protein kinase RYK; Vik
Common Name RYK
Gene Symbol RYK
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LWELMTLGQTPYVDIDPFEMAAYLKDGYRIAQPINCPDELFAVMACCWALDPEERPKFQQLVQCLTEFHAALG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.