Invitrogen™ Human RWDD4 (aa 12-96) Control Fragment Recombinant Protein

Product Code. 30194577

Brand: Invitrogen™ RP96767

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57691 (PA5-57691. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q6NW29
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 201965
• Name: Human RWDD4 (aa 12-96) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BC016198; FAM28A; family with sequence similarity 28, member A; Gm1942; Protein FAM28A; RWD domain containing 4; RWD domain containing 4 A; RWD domain-containing protein 4; RWD domain-containing protein 4 A; Rwdd4; Rwdd4a
• Common Name: RWDD4
• Gene Symbol: RWDD4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EALRSIYEGDESFRELSPVSFQYRIGENGDPKAFLIEISWTETYPQTPPILSMNAFFNNTISSAVKQSILAKLQEAVEANLGTAM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining