missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30201617

Invitrogen™ Human Rwdd1 (aa 14-82) Control Fragment Recombinant Protein

Product Code. 30201617
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30201617

Brand: Invitrogen™ RP94635

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55959 (PA5-55959. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Formin-like protein 1 (FRL1) gene encodes a formin-related protein which has been implicated in morphogenesis, cyokinesis, and cell polarity. Formins are a conserved class of proteins expressed in all eukaryotes and have one DAD (diaphanous autoregulatory domain), one FH2 (formin homology 2) domain and one GBD/FH3 (Rho GTPase-binding / formin homology 3) domain. FRL1 is located in the cytoplasm and is highly expressed in the spleen, lymph node and bone marrow cells. FRL1 possibly has a role in the control of cell motility, survival of macrophages and cytoskeletal organization.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9H446
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51389
Name Human Rwdd1 (aa 14-82) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0710001K08Rik; 2610002D06Rik; 2700069A07Rik; CGI-24; DFRP2; DRG family-regulatory protein 2; IH1; PTD013; RWD domain containing 1; RWD domain-containing protein 1; Rwdd1; Sarip; small androgen receptor-interacting protein
Common Name Rwdd1
Gene Symbol RWDD1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ALESIYPDSFTVLSENPPSFTITVTSEAGENDETVQTTLKFTYSEKYPDEAPLYEIFSQENLEDNDVSD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.