missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RUVBL1 (aa 70-149) Control Fragment Recombinant Protein

Product Code. 30208358
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30208358

Brand: Invitrogen™ RP91879

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110857 (PA5-110857. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the eukaryotic diacylglycerol kinase family. It may attenuate protein kinase C activity by regulating diacylglycerol levels in intracellular signaling cascade and signal transduction. Alternative splicing occurs at this locus and four transcript variants encoding distinct isoforms have been identified.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y265
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8607
Name Human RUVBL1 (aa 70-149) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2510009G06Rik; 49 kDa TATA box-binding protein-interacting protein; 49 kDa TBP-interacting protein; 54 kDa erythrocyte cytosolic protein; DNA helicase p50; ECP54; ECP-54; INO80 complex subunit H; INO80H; NMP 238; NMP238; Nuclear matrix protein 238; PONTIN; Pontin 52; Pontin52; RuvB (E coli homolog)-like 1; RuvB like AAA ATPase 1; Ruvbl1; ruvB-like 1; RuvB-like AAA ATPase 1; RuvB-like protein 1; RVB1; TAP54-alpha; TATA binding protein interacting protein 49 kDa; TIH1; Tip49; TIP49A; TIP60-a; TIP60-associated protein 54-alpha
Common Name RUVBL1
Gene Symbol RUVBL1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.