Invitrogen™ Human RUFY1 (aa 330-408) Control Fragment Recombinant Protein

Product Code. 30198591

Brand: Invitrogen™ RP96952

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58546 (PA5-58546. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that contains a RUN domain and a FYVE-type zinc finger domain. The encoded protein binds to phosphatidylinositol-3-phosphate (PI3P) and plays a role in early endosomal trafficking, tethering and fusion through interactions with small GTPases including Rab4, Rab5 and Rab14. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Specifications

• Accession Number: Q96T51
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 80230
• Name: Human RUFY1 (aa 330-408) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 3000002E04Rik; FYVE-finger containing protein; FYVE-finger protein EIP1; La-binding protein 1; Rab4a interacting protein; rab4-interacting protein; Rabip4; RUFY1; RUN and FYVE domain containing 1; RUN and FYVE domain-containing protein 1; ZFYVE12; zinc finger FYVE domain-containing protein 12
• Common Name: RUFY1
• Gene Symbol: RUFY1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DGLEKTNSKLQEELSAATDRICSLQEEQQQLREQNELIRERSEKSVEITKQDTKVELETYKQTRQGLDEMYSDVWKQLK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining