Invitrogen™ Human RTRAF (aa 8-107) Control Fragment Recombinant Protein

Product Code. 30182762

Brand: Invitrogen™ RP98350

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58944 (PA5-58944. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RTRAF (C14orf166) is an RNA-binding protein involved in modulation of mRNA transcription by Polymerase II (PubMed:16950395). Component of the tRNA-splicing ligase complex and is required for tRNA ligation (PubMed:24870230). May be required for RNA transport (PubMed:24608264).

Specifications

• Accession Number: Q9Y224
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51637
• Name: Human RTRAF (aa 8-107) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2700060E02Rik; C14orf166; CGI99; CGI-99; chromosome 14 open reading frame 166; CLE; CLE7; CLE7 homolog; hCLE1; LCRP369; LRRGT00192; RGD1304704; RIKEN cDNA 2700060E02 gene; RLL motif containing 1; RLLM1; RNA transcription, translation and transport factor protein; RTRAF; similar to Hypothetical protein CGI-99; UPF0568 protein C14orf166; UPF0568 protein C14orf166 homolog
• Common Name: RTRAF
• Gene Symbol: RTRAF
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining