Invitrogen™ Human RTN4RL1 (aa 279-391) Control Fragment Recombinant Protein

Product Code. 30211757

Brand: Invitrogen™ RP88806

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60710 (PA5-60710. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RTN4RL1 may play a role in regulating axonal regeneration and plasticity in the adult central nervous system.

Specifications

• Accession Number: Q86UN2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 146760
• Name: Human RTN4RL1 (aa 279-391) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: NgR3; Ngrh2; NGRL2; Nogo receptor-like 2; Nogo-66 receptor homolog 2; Nogo-66 receptor-related protein 3; reticulon 4 receptor like 1; reticulon 4 receptor-like 1; reticulon-4 receptor-like 1; RGD:727812}; Rtn4rl1; rtn4rl1 {ECO:0000312
• Common Name: RTN4RL1
• Gene Symbol: Rtn4rl1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AVPCVSPGLRHGQDLKLLRAEDFRNCTGPASPHQIKSHTLTTTDRAARKEHHSPHGPTRSKGHPHGPRPGHRKPGKNCTNPRNRNQISKAGAGKQAPELPDYAPDYQHKFSFD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining