Invitrogen™ Human RTN3 (aa 81-217) Control Fragment Recombinant Protein

Product Code. 30209725

Brand: Invitrogen™ RP90846

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (53%), Rat (53%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53360 (PA5-53360. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RTN3 is a member of reticulons, which are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. Alternatively spliced transcript variants encoding different isoforms have been identified. Multiple promoters rather than alternative splicing of internal exons seem to be involved in this diversity.

Specifications

• Accession Number: O95197
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10313
• Name: Human RTN3 (aa 81-217) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ASY interacting protein; ASYIP; HAP; Homolog of ASY protein; neuroendocrine-specific protein-like 2; Neuroendocrine-specific protein-like II; nsp-c; NSPL2; NSPLII; Nsp-like II; NSP-like protein 2; NSP-like protein II; reticulon 3; reticulon-3; RTN3; RTN3-A1
• Common Name: RTN3
• Gene Symbol: RTN3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IMTSSFLSSSEIHNTGLTILHGEKSHVLGSQPILAKEGKDHLDLLDMKKMEKPQGTSNNVSDSSVSLAAGVHCDRPSIPASFPEHPAFLSKKIGQVEEQIDKETKNPNGVSSREAKTALDADDRFTLLTAQKPPTEY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining