Invitrogen™ Human RTCA (aa 111-193) Control Fragment Recombinant Protein

Product Code. 30194071

Brand: Invitrogen™ RP94251

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55742 (PA5-55742. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RTCD1 catalyzes the conversion of 3'-phosphate to a 2', 3'-cyclic phosphodiester at the end of RNA. The mechanism of action of the enzyme occurs in 3 steps: (A) adenylation of the enzyme by ATP; (B) the enzyme acts on RNA-N3'P to produce RNA-N3'PP5'A; (C) a non catalytic nucleophilic attack by the adjacent 2'hydroxyl on the phosphorus in the diester linkage to produce the cyclic end product. The biological role of this enzyme is unknown but it is likely to function in some aspects of cellular RNA processing. There are two named isoforms.

Specifications

• Accession Number: O00442
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8634
• Name: Human RTCA (aa 111-193) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310009A18Rik; AI450277; RNA 3'-terminal phosphate cyclase; RNA cyclase; RNA terminal phosphate cyclase domain 1; RNA terminal phosphate cyclase domain-containing protein 1; RNA-3'-phosphate cyclase; RPC; Rpc1; RTC domain-containing protein 1; RTC1; RTCA; Rtcd1
• Common Name: RTCA
• Gene Symbol: RTCA
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LFAASPSELHLKGGTNAEMAPQIDYTVMVFKPIVEKFGFIFNCDIKTRGYYPKGGGEVIVRMSPVKQLNPINLTERGCVTKIY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining