Invitrogen™ Human RSPH4A (aa 22-94) Control Fragment Recombinant Protein

Product Code. 30210049

Brand: Invitrogen™ RP94636

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (41%), Rat (41%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56666 (PA5-56666. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that appears to be a component the radial spoke head, as determined by homology to similar proteins in the biflagellate alga Chlamydomonas reinhardtii and other ciliates. Radial spokes, which are regularly spaced along cilia, sperm, and flagella axonemes, consist of a thin 'stalk' and a bulbous 'head' that form a signal transduction scaffold between the central pair of microtubules and dynein. Mutations in this gene cause primary ciliary dyskinesia 1, a disease arising from dysmotility of motile cilia and sperm. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: Q5TD94
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 345895
• Name: Human RSPH4A (aa 22-94) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A230081C05; CILD11; dJ412I7.1; radial spoke head 4 homolog A; radial spoke head 4 homolog A (Chlamydomonas); radial spoke head protein 4 homolog A; Radial spoke head-like protein 3; radial spokehead-like 3; RSHL3; Rsph4a; RSPH6B
• Common Name: RSPH4A
• Gene Symbol: RSPH4A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RPWEGKTAASPQYSEPESSEPLEAKQGPETGRQSRSSRPWSPQSRAKTPLGGPAGPETSSPAPVSPREPSSSP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining