Invitrogen™ Human RSL24D1 (aa 82-132) Control Fragment Recombinant Protein

Product Code. 30209902

Brand: Invitrogen™ RP103466

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64058 (PA5-64058. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein sharing a low level of sequence similarity with human ribosomal protein L24. Although this gene has been referred to as RPL24, L30, and 60S ribosomal protein L30 isolog in the sequence databases, it is distinct from the human genes officially named RPL24 (which itself has been referred to as ribosomal protein L30) and RPL30. The protein encoded by this gene localizes to the nucleolus and is thought to play a role in the biogenesis of the 60S ribosomal subunit. The precise function of this gene is currently unknown. This gene utilizes alternative polyadenylation signals and has multiple pseudogenes.

Specifications

• Accession Number: Q9UHA3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51187
• Name: Human RSL24D1 (aa 82-132) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2410159K22Rik; 60 S ribosomal protein L30 isolog; C15orf15; homolog of yeast ribosomal like protein 24; HRP-L30-iso; L30; My024; my024 protein; probable ribosome biogenesis protein RLP24; ribosomal L24 domain containing 1; ribosomal L24 domain-containing protein 1; Ribosomal protein L24-like; RLP24; RPL24; RPL24L; RSL24D1; TVAS3
• Common Name: RSL24D1
• Gene Symbol: RSL24D1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining