missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30211513

Invitrogen™ Human RSK4 (aa 346-461) Control Fragment Recombinant Protein

Product Code. 30211513
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211513

Brand: Invitrogen™ RP92168

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82038 (PA5-82038. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RPS6KA6 (RSK4) is a member of the RSK kinases family. RSK family members are activated by ERKs and mitogens and are unusual in that they contain 2 non-identical kinase domains. RSK4 encodes a member of ribosomal S6 kinase family, serine-threonine protein kinases which are regulated by growth factors. The encoded protein may be distinct from other members of this family, however, as studies suggest it is not growth factor dependent and may not participate in the same signaling pathways.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UK32
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 27330
Name Human RSK4 (aa 346-461) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610524K04Rik; 90 kDa ribosomal protein S6 kinase 6; p90-RSK 6; p90RSK6; pp90RSK4; RGD1560817; ribosomal protein S6 kinase A6; ribosomal protein S6 kinase alpha-6; ribosomal protein S6 kinase polypeptide 6; ribosomal protein S6 kinase, 90 kDa, polypeptide 6; ribosomal S6 kinase 4; Rps6ka6; RSK4; RSK-4; S6KA6; S6K-alpha 6; S6K-alpha-6
Common Name RSK4
Gene Symbol Rps6ka6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PFKPASGKPDDTFCFDPEFTAKTPKDSPGLPASANAHQLFKGFSFVATSIAEEYKITPITSANVLPIVQINGNAAQFGEVYELKEDIGVGSYSVCKRCIHATTNMEFAVKIIDKSK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.