missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RSG1 (aa 83-175) Control Fragment Recombinant Protein

Product Code. 30207926
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207926

Brand: Invitrogen™ RP106013

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65309 (PA5-65309. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Potential effector of the planar cell polarity signaling pathway. Plays a role in targeted membrane trafficking most probably at the level of vesicle fusion with membranes. Involved in cilium biogenesis by regulating the transport of cargo proteins to the basal body and to the apical tips of cilia. More generally involved in exocytosis in secretory cells.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9BU20
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79363
Name Human RSG1 (aa 83-175) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6330545A04Rik; C1orf89; Ciliogenesis and planar polarity effector 2; ciliogenesis and planar polarity effector 2; REM2- and Rab-like small GTPase 1; CPLANE2; Gm723; im:7136213; miro domain-containing protein C1orf89; miro domain-containing protein C1orf89 homolog; Rem/Rab-Similar GTPase 1; REM2 and RAB like small GTPase 1; REM2- and Rab-like small GTPase 1; REM2 and RAB-like small GTPase 1; RGD1561421; RSG1; zgc:101035; zgc:101035 protein; zgc:113864
Common Name RSG1
Gene Symbol RSG1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VHHETTGIQTTVVFWPAKLQASSRVVMFRFEFWDCGESALKKFDHMLLACMENTDAFLFLFSFTDRASFEDLPGQLARIAGEAPGVVRMVIGS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.