missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RSF1 (aa 124-215) Control Fragment Recombinant Protein

Product Code. 30209963
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209963

Brand: Invitrogen™ RP106109

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83806 (PA5-83806. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RSF1 is required for assembly of regular nucleosome arrays by the RSF chromatin remodelling complex. Rsf1 facilitates transcription of hepatitis B virus (HBV) genes by the pX transcription activator. In case of infection by HBV, together with pX, it represses TNF-alpha induced NF-kappaB transcription activation. Rsf1 represses transcription when artificially recruited to chromatin by fusion to a heterogeneous DNA binding domain. Rsf1 interacts with SMARCA5/SNF2H to form the RSF complex and also binds the HBV pX/HBx protein, which is required to activate transcription of the viral genome.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96T23
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51773
Name Human RSF1 (aa 124-215) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4832420A03Rik; C030033M12Rik; Gm164; HBV pX associated protein-8; HBV pX-associated protein 8; HBXAP; hepatitis B virus x associated protein; hepatitis B virus x-associated protein; p325; p325 subunit of RSF chromatin-remodeling complex; Remodeling and spacing factor 1; RSF1; RSF-1; XAP8
Common Name RSF1
Gene Symbol RSF1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KYLCECQFDDNLKFKNIINEEDADTMRLQPIGRDKDGLMYWYQLDQDHNVRMYIEEQDDQDGSSWKCIVRNRNELAETLALLKAQIDPVLLK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.