Invitrogen™ Human RRS1 (aa 207-280) Control Fragment Recombinant Protein

Product Code. 30195732

Brand: Invitrogen™ RP93929

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63144 (PA5-63144. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Involved in ribosomal large subunit assembly. May regulate the localization of the 5S RNP/5S ribonucleoprotein particle to the nucleolus. [UniProt]

Specifications

• Accession Number: Q15050
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23212
• Name: Human RRS1 (aa 207-280) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5730466A07Rik; AA415037; D1Ertd701e; homolog of yeast ribosome biogenesis regulator; homolog of yeast ribosome biogenesis regulatory protein RRS1; KIAA0112; MNCb-2643; regulator for ribosome resistance homolog; ribosome biogenesis regulator homolog; ribosome biogenesis regulatory protein homolog; ribosome biogenesis regulatory protein RRS1 homolog; Rrr; Rrs1; RRS1 ribosome biogenesis regulator homolog; RRS1 ribosome biogenesis regulator homolog (S. cerevisiae)
• Common Name: RRS1
• Gene Symbol: Rrs1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LHPTGHQSKEELGRAMQVAKVSTASVGRFQERLPKEKVPRGSGKKRKFQPLFGDFAAEKKNQLELLRVMNSKKP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining