missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30202973

Invitrogen™ Human RRBP1 (aa 1055-1178) Control Fragment Recombinant Protein

Product Code. 30202973
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202973

Brand: Invitrogen™ RP90187

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82444 (PA5-82444. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Analysis of cDNA clones indicates that ribosome binding protein 1 may exist in different forms due to removal of tandem repeats, or partial intraexonic splicing of RRBP1. The form presented here is lacking the canine p180 ribosome-binding domain, NQGKKAEGAQ, which is tandemly repeated close to the N-terminus in other forms that haven't been fully characterized. RRBP1 has been excluded as a candidate gene in the cause of Alagille syndrome. Alternate splicing results in multiple transcript variants.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9P2E9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6238
Name Human RRBP1 (aa 1055-1178) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700087N07Rik; 180 kDa ribosome receptor homolog; 5730465C04Rik; ES/130; ES/130-related protein; ES130; hES; KIAA1398; mKIAA1398; mRRp; mRRp0; mRRp1.8; mRRp10; mRRp15a; mRRp15b; mRRp16.8; mRRp2; mRRp41; mRRp47; mRRp5.4; p180; ribosome binding protein 1; ribosome binding protein 1 homolog 180 kDa (dog); ribosome receptor protein; Ribosome-binding protein 1; RP11-462D18.3; Rrbp1; RRp
Common Name RRBP1
Gene Symbol RRBP1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QLCLIEAQTMEALLALLPELSVLAQQNYTEWLQDLKEKGPTLLKHPPAPAEPSSDLASKLREAEETQSTLQAECDQYRSILAETEGMLRDLQKSVEEEEQVWRAKVGAAEEELQKSRVTVKHLE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.