missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30203371

Invitrogen™ Human RQCD1 (aa 57-139) Control Fragment Recombinant Protein

Product Code. 30203371
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203371

Brand: Invitrogen™ RP95647

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61261 (PA5-61261. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the highly conserved RCD1 protein family. The encoded protein is a transcriptional cofactor and a core protein of the CCR4-NOT complex. It may be involved in signal transduction as well as retinoic acid-regulated cell differentiation and development. Alternatively spliced transcript variants have been described for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q92600
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9125
Name Human RQCD1 (aa 57-139) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610007F23Rik; AI593551; CAF40; cancer/testis antigen 129; CCR4-NOT transcription complex subunit 9; cell differentiation protein RCD1 homolog; cell differentiation protein RCD1 homolog; CCR4-NOT transcription complex subunit 9; cell differentiation protein RQCD1 homolog; CNOT9; CT129; EPO-induced protein FL10; Fl10; protein involved in sexual development; rcd1; rcd-1; rcd1 (required for cell differentiation) homolog 1; rcd1 (required for cell differentiation) homolog 1 (S. pombe); RCD1 required for cell differentiation1 homolog; Rcd1 required for cell differentiation1 homolog (S. pombe); rqcd1; si:dkeyp-84a8.6; wu:fb52b11; wu:fb74e08; zgc:85618
Common Name RQCD1
Gene Symbol CNOT9
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence WHSFGTIAALLQEIVNIYPSINPPTLTAHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.