Invitrogen™ Human RPS6KC1 (aa 800-910) Control Fragment Recombinant Protein

Product Code. 30198539

Brand: Invitrogen™ RP105858

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83197 (PA5-83197. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May be involved in transmitting sphingosine-1 phosphate (SPP)-mediated signaling into the cell. Plays a role in the recruitment of PRDX3 to early endosomes.

Specifications

• Accession Number: Q96S38
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 26750
• Name: Human RPS6KC1 (aa 800-910) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 52 kDa ribosomal protein S6 kinase; AA682037; B130003F20Rik; C80612; humS6PKh1; ribosomal protein S6 kinase C1; ribosomal protein S6 kinase delta-1; ribosomal protein S6 kinase polypeptide 1; ribosomal protein S6 kinase, 52 kDa, polypeptide 1; ribosomal S6 kinase-like protein with two PSK domains 118 kDa protein; RPK118; Rps6kc1; RSKL1; S6K-delta-1; S6PKh1; SPHK1-binding protein
• Common Name: RPS6KC1
• Gene Symbol: RPS6KC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QGLGVVESAVTANNTEESLFRICSPLSGANEYIASTDTLKTEEVLLFTDQTDDLAKEEPTSLFQRDSETKGESGLVLEGDKEIHQIFEDLDKKLALASRFYIPEGCIQRWA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining