missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30202077

Invitrogen™ Human RPS3 (aa 165-242) Control Fragment Recombinant Protein

Product Code. 30202077
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202077

Brand: Invitrogen™ RP103505

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64109 (PA5-64109. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

WD repeat domain 5 (WDR5) is a member of the WD repeat protein family, which is involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. WDR5, also known as BIG-3, is expressed in the developing growth plate, accelerates chondrocyte and osteoblast differentiation in vitro, and regulates osteoblast differentiation during embryonic bone development. WDR5 interacts with the pluripotency factor Oct4/POU5F1 and is required for the efficient formation of induced pluripotent stem (iPS) cells.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P23396
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6188
Name Human RPS3 (aa 165-242) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 40 S ribosomal protein S3; D7Ertd795e; FLJ26283; FLJ27450; IMR-90 ribosomal protein S3; MGC87870; OK/SW-cl0.26; OTTHUMP00000229804; OTTHUMP00000229805; OTTHUMP00000229874; OTTHUMP00000229877; OTTHUMP00000229878; OTTHUMP00000229879; OTTHUMP00000229880; OTTHUMP00000229882; OTTHUMP00000229883; OTTHUMP00000229886; ribosomal protein S3; Rps3; Rs_3; S3; Small ribosomal subunit protein uS3
Common Name RPS3
Gene Symbol RPS3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NYYVDTAVRHVLLRQGVLGIKVKIMLPWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPVPT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.