Invitrogen™ Human RPS27A (aa 94-155) Control Fragment Recombinant Protein

Product Code. 30199741

Brand: Invitrogen™ RP106507

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ubiquitin, a highly conserved protein that has a major role in targeting cellular proteins for degradation by the 26S proteosome, is synthesized as a precursor protein consisting of either polyubiquitin chains or a single ubiquitin fused to an unrelated protein. This gene encodes a fusion protein consisting of ubiquitin at the N terminus and ribosomal protein S27a at the C terminus. When expressed in yeast, the protein is post-translationally processed, generating free ubiquitin monomer and ribosomal protein S27a. Ribosomal protein S27a is a component of the 40S subunit of the ribosome and belongs to the S27AE family of ribosomal proteins. It contains C4-type zinc finger domains and is located in the cytoplasm. Pseudogenes derived from this gene are present in the genome. As with ribosomal protein S27a, ribosomal protein L40 is also synthesized as a fusion protein with ubiquitin; similarly, ribosomal protein S30 is synthesized as a fusion protein with the ubiquitin-like protein fubi. Multiple alternatively spliced transcript variants that encode the same proteins have been identified.

Specifications

• Accession Number: P62979
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6233
• Name: Human RPS27A (aa 94-155) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 0610006J14Rik; 40 S ribosomal protein S27a; CEP80; epididymis luminal protein 112; HEL112; LOC100912032; ribosomal protein S27a; Rps27a; S27A; Small ribosomal subunit protein eS31; Uba52; UBA80; Ubb; UBC; UBCEP1; UBCEP80; Ubiquitin; ubiquitin and ribosomal protein S27a; ubiquitin C; ubiquitin carboxyl extension protein 80; Ubiquitin-40 S ribosomal protein S27a; ubiquitin-40 S ribosomal protein S27a-like; ubiquitin-CEP80
• Common Name: RPS27A
• Gene Symbol: RPS27A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPED
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining