Invitrogen™ Human RPS17 (aa 67-108) Control Fragment Recombinant Protein

Product Code. 30213013

Brand: Invitrogen™ RP100843

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63059 (PA5-63059. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ribosomes, the organelles that catalyze protein synthesis, are composed of a small subunit (40S) and a large subunit (60S) that consist of over 80 distinct ribosomal proteins. Mammalian ribosomal proteins are encoded by multigene families that contain processed pseudogenes and one functional intron-containing gene within their coding regions. Ribosomal Protein S17, also known as RPS17, RPS17L1 or RPS17L2, is a 135 amino acid protein that is a component of the 40S subunit. Localized to the cytoplasm and expressed ubiquitously, Ribosomal Protein S17 belongs to the S17e family of ribosomal proteins and functions in protein synthesis. Mutations in the gene encoding Ribosomal Protein S17 are associated with Diamond-Blackfan anemia (DBA), a rare congenital disorder characterized by defective differentiation of pro-erythroblasts. Like most ribosomal proteins, Ribosomal Protein S17 exists as multiple processed pseudogenes that are scattered throughout the genome.

Specifications

• Accession Number: P08708
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6218
• Name: Human RPS17 (aa 67-108) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 40 S ribosomal protein S17; DBA4; ribosomal protein S17; Rps17; RPS17L; RPS17L1; RPS17L2; S17; Small ribosomal subunit protein eS17
• Common Name: RPS17
• Gene Symbol: Rps17
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RGISIKLQEEERERRDNYVPEVSALDQEIIEVDPDTKEMLKL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining